Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048979-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CYP21A2
Alternative Gene Name: CA21H, CAH1, CPS1, CYP21, CYP21B, P450c21B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024365: 69%, ENSRNOG00000000428: 67%
Entrez Gene ID: 1589
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSRNYPDLSLGDYSLLW |
Gene Sequence | GLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSRNYPDLSLGDYSLLW |
Gene ID - Mouse | ENSMUSG00000024365 |
Gene ID - Rat | ENSRNOG00000000428 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation) | |
Datasheet | Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation) | |
Datasheet | Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation) |
Citations for Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation) – 2 Found |
Johnston, Zoe C; Bellingham, Michelle; Filis, Panagiotis; Soffientini, Ugo; Hough, Denise; Bhattacharya, Siladitya; Simard, Marc; Hammond, Geoffrey L; King, Peter; O'Shaughnessy, Peter J; Fowler, Paul A. The human fetal adrenal produces cortisol but no detectable aldosterone throughout the second trimester. Bmc Medicine. 2018;16(1):23. PubMed |
Tevosian, Sergei G; Jiménez, Elizabeth; Hatch, Heather M; Jiang, Tianyu; Morse, Deborah A; Fox, Shawna C; Padua, Maria B. Adrenal Development in Mice Requires GATA4 and GATA6 Transcription Factors. Endocrinology. 2015;156(7):2503-17. PubMed |