Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA048979-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 21, subfamily A, polypeptide 2
Gene Name: CYP21A2
Alternative Gene Name: CA21H, CAH1, CPS1, CYP21, CYP21B, P450c21B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024365: 69%, ENSRNOG00000000428: 67%
Entrez Gene ID: 1589
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSRNYPDLSLGDYSLLW
Gene Sequence GLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSRNYPDLSLGDYSLLW
Gene ID - Mouse ENSMUSG00000024365
Gene ID - Rat ENSRNOG00000000428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation)
Datasheet Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation)
Datasheet Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation)
Citations for Anti CYP21A2 pAb (ATL-HPA048979 w/enhanced validation) – 2 Found
Johnston, Zoe C; Bellingham, Michelle; Filis, Panagiotis; Soffientini, Ugo; Hough, Denise; Bhattacharya, Siladitya; Simard, Marc; Hammond, Geoffrey L; King, Peter; O'Shaughnessy, Peter J; Fowler, Paul A. The human fetal adrenal produces cortisol but no detectable aldosterone throughout the second trimester. Bmc Medicine. 2018;16(1):23.  PubMed
Tevosian, Sergei G; Jiménez, Elizabeth; Hatch, Heather M; Jiang, Tianyu; Morse, Deborah A; Fox, Shawna C; Padua, Maria B. Adrenal Development in Mice Requires GATA4 and GATA6 Transcription Factors. Endocrinology. 2015;156(7):2503-17.  PubMed