Anti CYP20A1 pAb (ATL-HPA055872)

Atlas Antibodies

Catalog No.:
ATL-HPA055872-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 20, subfamily A, polypeptide 1
Gene Name: CYP20A1
Alternative Gene Name: CYP-M
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049439: 95%, ENSRNOG00000017631: 93%
Entrez Gene ID: 57404
Uniprot ID: Q6UW02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDVLKQHINPNKTLDPFETMLKSL
Gene Sequence PGITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDVLKQHINPNKTLDPFETMLKSL
Gene ID - Mouse ENSMUSG00000049439
Gene ID - Rat ENSRNOG00000017631
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYP20A1 pAb (ATL-HPA055872)
Datasheet Anti CYP20A1 pAb (ATL-HPA055872) Datasheet (External Link)
Vendor Page Anti CYP20A1 pAb (ATL-HPA055872) at Atlas Antibodies

Documents & Links for Anti CYP20A1 pAb (ATL-HPA055872)
Datasheet Anti CYP20A1 pAb (ATL-HPA055872) Datasheet (External Link)
Vendor Page Anti CYP20A1 pAb (ATL-HPA055872)