Anti CYP20A1 pAb (ATL-HPA055872)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055872-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CYP20A1
Alternative Gene Name: CYP-M
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049439: 95%, ENSRNOG00000017631: 93%
Entrez Gene ID: 57404
Uniprot ID: Q6UW02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PGITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDVLKQHINPNKTLDPFETMLKSL |
| Gene Sequence | PGITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDVLKQHINPNKTLDPFETMLKSL |
| Gene ID - Mouse | ENSMUSG00000049439 |
| Gene ID - Rat | ENSRNOG00000017631 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYP20A1 pAb (ATL-HPA055872) | |
| Datasheet | Anti CYP20A1 pAb (ATL-HPA055872) Datasheet (External Link) |
| Vendor Page | Anti CYP20A1 pAb (ATL-HPA055872) at Atlas Antibodies |
| Documents & Links for Anti CYP20A1 pAb (ATL-HPA055872) | |
| Datasheet | Anti CYP20A1 pAb (ATL-HPA055872) Datasheet (External Link) |
| Vendor Page | Anti CYP20A1 pAb (ATL-HPA055872) |