Anti CYHR1 pAb (ATL-HPA053653)

Atlas Antibodies

Catalog No.:
ATL-HPA053653-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cysteine/histidine-rich 1
Gene Name: CYHR1
Alternative Gene Name: CHRP, KIAA0496, MGC13010
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053929: 91%, ENSRNOG00000014811: 91%
Entrez Gene ID: 50626
Uniprot ID: Q6ZMK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ
Gene Sequence ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ
Gene ID - Mouse ENSMUSG00000053929
Gene ID - Rat ENSRNOG00000014811
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYHR1 pAb (ATL-HPA053653)
Datasheet Anti CYHR1 pAb (ATL-HPA053653) Datasheet (External Link)
Vendor Page Anti CYHR1 pAb (ATL-HPA053653) at Atlas Antibodies

Documents & Links for Anti CYHR1 pAb (ATL-HPA053653)
Datasheet Anti CYHR1 pAb (ATL-HPA053653) Datasheet (External Link)
Vendor Page Anti CYHR1 pAb (ATL-HPA053653)