Anti CYGB pAb (ATL-HPA061642)

Atlas Antibodies

Catalog No.:
ATL-HPA061642-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cytoglobin
Gene Name: CYGB
Alternative Gene Name: HGB, STAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020810: 95%, ENSRNOG00000011541: 93%
Entrez Gene ID: 114757
Uniprot ID: Q8WWM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDV
Gene Sequence MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDV
Gene ID - Mouse ENSMUSG00000020810
Gene ID - Rat ENSRNOG00000011541
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYGB pAb (ATL-HPA061642)
Datasheet Anti CYGB pAb (ATL-HPA061642) Datasheet (External Link)
Vendor Page Anti CYGB pAb (ATL-HPA061642) at Atlas Antibodies

Documents & Links for Anti CYGB pAb (ATL-HPA061642)
Datasheet Anti CYGB pAb (ATL-HPA061642) Datasheet (External Link)
Vendor Page Anti CYGB pAb (ATL-HPA061642)