Anti CYFIP2 pAb (ATL-HPA071459)

Atlas Antibodies

Catalog No.:
ATL-HPA071459-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cytoplasmic FMR1 interacting protein 2
Gene Name: CYFIP2
Alternative Gene Name: PIR121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020340: 100%, ENSRNOG00000010348: 40%
Entrez Gene ID: 26999
Uniprot ID: Q96F07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STQACQWSPRALFHPTGGTQGRRGCRSLLY
Gene Sequence STQACQWSPRALFHPTGGTQGRRGCRSLLY
Gene ID - Mouse ENSMUSG00000020340
Gene ID - Rat ENSRNOG00000010348
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYFIP2 pAb (ATL-HPA071459)
Datasheet Anti CYFIP2 pAb (ATL-HPA071459) Datasheet (External Link)
Vendor Page Anti CYFIP2 pAb (ATL-HPA071459) at Atlas Antibodies

Documents & Links for Anti CYFIP2 pAb (ATL-HPA071459)
Datasheet Anti CYFIP2 pAb (ATL-HPA071459) Datasheet (External Link)
Vendor Page Anti CYFIP2 pAb (ATL-HPA071459)