Anti CYC1 pAb (ATL-HPA001247 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001247-25

• 
• 
• 

Protein Description: cytochrome c-1
Gene Name: CYC1
Alternative Gene Name: UQCR4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022551: 92%, ENSRNOG00000012457: 92%
Entrez Gene ID: 1537
Uniprot ID: P08574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYR
• Gene Sequence: NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYR
• Gene ID - Mouse: ENSMUSG00000022551
• Gene ID - Rat: ENSRNOG00000012457
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CYC1 pAb (ATL-HPA001247 w/enhanced validation) – 4 Found

Robinson, David R L; Hock, Daniella H; Muellner-Wong, Linden; Kugapreethan, Roopasingam; Reljic, Boris; Surgenor, Elliot E; Rodrigues, Carlos H M; Caruana, Nikeisha J; Stroud, David A. Applying Sodium Carbonate Extraction Mass Spectrometry to Investigate Defects in the Mitochondrial Respiratory Chain. Frontiers In Cell And Developmental Biology. 10( 35300415):786268. 

Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. 

Desmurs, Marjorie; Foti, Michelangelo; Raemy, Etienne; Vaz, Frédéric Maxime; Martinou, Jean-Claude; Bairoch, Amos; Lane, Lydie. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Molecular And Cellular Biology. 2015;35(7):1139-56. 

Pereira, Susana P; Oliveira, Paulo J; Tavares, Ludgero C; Moreno, António J; Cox, Laura A; Nathanielsz, Peter W; Nijland, Mark J. Effects of moderate global maternal nutrient reduction on fetal baboon renal mitochondrial gene expression at 0.9 gestation. American Journal Of Physiology. Renal Physiology. 2015;308(11):F1217-28.