Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014757-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CYBRD1
Alternative Gene Name: CYB561A2, DCYTB, FLJ23462, FRRS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027015: 51%, ENSRNOG00000009620: 57%
Entrez Gene ID: 79901
Uniprot ID: Q53TN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM |
| Gene Sequence | VTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM |
| Gene ID - Mouse | ENSMUSG00000027015 |
| Gene ID - Rat | ENSRNOG00000009620 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation) | |
| Datasheet | Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation) | |
| Datasheet | Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation) |
| Citations for Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation) – 3 Found |
| Lemler, David J; Lynch, Miranda L; Tesfay, Lia; Deng, Zhiyong; Paul, Bibbin T; Wang, Xiaohong; Hegde, Poornima; Manz, David H; Torti, Suzy V; Torti, Frank M. DCYTB is a predictor of outcome in breast cancer that functions via iron-independent mechanisms. Breast Cancer Research : Bcr. 2017;19(1):25. PubMed |
| Qing, Mingjie; Zhou, Jiahao; Chen, Weijian; Cheng, Lijuan. Highly Expressed CYBRD1 Associated with Glioma Recurrence Regulates the Immune Response of Glioma Cells to Interferon. Evidence-Based Complementary And Alternative Medicine : Ecam. 2021( 34326882):2793222. PubMed |
| Balusikova, Kamila; Dostalikova-Cimburova, Marketa; Tacheci, Ilja; Kovar, Jan. Expression profiles of iron transport molecules along the duodenum. Journal Of Cellular And Molecular Medicine. 2022;26(10):2995-3004. PubMed |