Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA014757-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cytochrome b reductase 1
Gene Name: CYBRD1
Alternative Gene Name: CYB561A2, DCYTB, FLJ23462, FRRS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027015: 51%, ENSRNOG00000009620: 57%
Entrez Gene ID: 79901
Uniprot ID: Q53TN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM
Gene Sequence VTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM
Gene ID - Mouse ENSMUSG00000027015
Gene ID - Rat ENSRNOG00000009620
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation)
Datasheet Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation)
Datasheet Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation)
Citations for Anti CYBRD1 pAb (ATL-HPA014757 w/enhanced validation) – 3 Found
Lemler, David J; Lynch, Miranda L; Tesfay, Lia; Deng, Zhiyong; Paul, Bibbin T; Wang, Xiaohong; Hegde, Poornima; Manz, David H; Torti, Suzy V; Torti, Frank M. DCYTB is a predictor of outcome in breast cancer that functions via iron-independent mechanisms. Breast Cancer Research : Bcr. 2017;19(1):25.  PubMed
Qing, Mingjie; Zhou, Jiahao; Chen, Weijian; Cheng, Lijuan. Highly Expressed CYBRD1 Associated with Glioma Recurrence Regulates the Immune Response of Glioma Cells to Interferon. Evidence-Based Complementary And Alternative Medicine : Ecam. 2021( 34326882):2793222.  PubMed
Balusikova, Kamila; Dostalikova-Cimburova, Marketa; Tacheci, Ilja; Kovar, Jan. Expression profiles of iron transport molecules along the duodenum. Journal Of Cellular And Molecular Medicine. 2022;26(10):2995-3004.  PubMed