Anti CYB5RL pAb (ATL-HPA060463)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060463-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CYB5RL
Alternative Gene Name: LOC606495
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028621: 65%, ENSRNOG00000009148: 59%
Entrez Gene ID:
Uniprot ID: Q6IPT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSKLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRYTQRDS |
| Gene Sequence | PSKLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRYTQRDS |
| Gene ID - Mouse | ENSMUSG00000028621 |
| Gene ID - Rat | ENSRNOG00000009148 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYB5RL pAb (ATL-HPA060463) | |
| Datasheet | Anti CYB5RL pAb (ATL-HPA060463) Datasheet (External Link) |
| Vendor Page | Anti CYB5RL pAb (ATL-HPA060463) at Atlas Antibodies |
| Documents & Links for Anti CYB5RL pAb (ATL-HPA060463) | |
| Datasheet | Anti CYB5RL pAb (ATL-HPA060463) Datasheet (External Link) |
| Vendor Page | Anti CYB5RL pAb (ATL-HPA060463) |