Anti CYB5RL pAb (ATL-HPA042671)

Atlas Antibodies

SKU:
ATL-HPA042671-25
  • Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cytochrome b5 reductase-like
Gene Name: CYB5RL
Alternative Gene Name: LOC606495
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028621: 77%, ENSRNOG00000009148: 76%
Entrez Gene ID:
Uniprot ID: Q6IPT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLPWSYQEKTHFGHLGQDLIKELVSCCRRKPFALVCGSAEFTKDIARCLLCAGLTEDSYFLF
Gene Sequence QLPWSYQEKTHFGHLGQDLIKELVSCCRRKPFALVCGSAEFTKDIARCLLCAGLTEDSYFLF
Gene ID - Mouse ENSMUSG00000028621
Gene ID - Rat ENSRNOG00000009148
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CYB5RL pAb (ATL-HPA042671)
Datasheet Anti CYB5RL pAb (ATL-HPA042671) Datasheet (External Link)
Vendor Page Anti CYB5RL pAb (ATL-HPA042671) at Atlas Antibodies

Documents & Links for Anti CYB5RL pAb (ATL-HPA042671)
Datasheet Anti CYB5RL pAb (ATL-HPA042671) Datasheet (External Link)
Vendor Page Anti CYB5RL pAb (ATL-HPA042671)