Anti CYB5R2 pAb (ATL-HPA038962)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038962-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CYB5R2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048065: 71%, ENSRNOG00000019751: 73%
Entrez Gene ID: 51700
Uniprot ID: Q6BCY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMI |
| Gene Sequence | MTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMI |
| Gene ID - Mouse | ENSMUSG00000048065 |
| Gene ID - Rat | ENSRNOG00000019751 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYB5R2 pAb (ATL-HPA038962) | |
| Datasheet | Anti CYB5R2 pAb (ATL-HPA038962) Datasheet (External Link) |
| Vendor Page | Anti CYB5R2 pAb (ATL-HPA038962) at Atlas Antibodies |
| Documents & Links for Anti CYB5R2 pAb (ATL-HPA038962) | |
| Datasheet | Anti CYB5R2 pAb (ATL-HPA038962) Datasheet (External Link) |
| Vendor Page | Anti CYB5R2 pAb (ATL-HPA038962) |