Anti CYB5R2 pAb (ATL-HPA038962)

Atlas Antibodies

Catalog No.:
ATL-HPA038962-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cytochrome b5 reductase 2
Gene Name: CYB5R2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048065: 71%, ENSRNOG00000019751: 73%
Entrez Gene ID: 51700
Uniprot ID: Q6BCY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMI
Gene Sequence MTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMI
Gene ID - Mouse ENSMUSG00000048065
Gene ID - Rat ENSRNOG00000019751
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYB5R2 pAb (ATL-HPA038962)
Datasheet Anti CYB5R2 pAb (ATL-HPA038962) Datasheet (External Link)
Vendor Page Anti CYB5R2 pAb (ATL-HPA038962) at Atlas Antibodies

Documents & Links for Anti CYB5R2 pAb (ATL-HPA038962)
Datasheet Anti CYB5R2 pAb (ATL-HPA038962) Datasheet (External Link)
Vendor Page Anti CYB5R2 pAb (ATL-HPA038962)