Anti CYB5R1 pAb (ATL-HPA014147 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA014147-100
  • Immunohistochemical staining of human cerebral cortex, kidney, pancreas and testis using Anti-CYB5R1 antibody HPA014147 (A) shows similar protein distribution across tissues to independent antibody HPA010641 (B).
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: cytochrome b5 reductase 1
Gene Name: CYB5R1
Alternative Gene Name: humb5R2, NQO3A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026456: 93%, ENSRNOG00000003973: 93%
Entrez Gene ID: 51706
Uniprot ID: Q9UHQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY
Gene Sequence GGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY
Gene ID - Mouse ENSMUSG00000026456
Gene ID - Rat ENSRNOG00000003973
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CYB5R1 pAb (ATL-HPA014147 w/enhanced validation)
Datasheet Anti CYB5R1 pAb (ATL-HPA014147 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CYB5R1 pAb (ATL-HPA014147 w/enhanced validation)