Anti CYB5D1 pAb (ATL-HPA021632)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021632-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CYB5D1
Alternative Gene Name: FLJ32499
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032889: 83%, ENSRNOG00000045742: 85%
Entrez Gene ID: 124637
Uniprot ID: Q6P9G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVAQHNRPEDLWVSYLGRVYDLTSLAQEYKGNLLLKPIVEVAGQDISHWFDPKTRDIRKHIDPLT |
| Gene Sequence | EVAQHNRPEDLWVSYLGRVYDLTSLAQEYKGNLLLKPIVEVAGQDISHWFDPKTRDIRKHIDPLT |
| Gene ID - Mouse | ENSMUSG00000032889 |
| Gene ID - Rat | ENSRNOG00000045742 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYB5D1 pAb (ATL-HPA021632) | |
| Datasheet | Anti CYB5D1 pAb (ATL-HPA021632) Datasheet (External Link) |
| Vendor Page | Anti CYB5D1 pAb (ATL-HPA021632) at Atlas Antibodies |
| Documents & Links for Anti CYB5D1 pAb (ATL-HPA021632) | |
| Datasheet | Anti CYB5D1 pAb (ATL-HPA021632) Datasheet (External Link) |
| Vendor Page | Anti CYB5D1 pAb (ATL-HPA021632) |