Anti CYB5D1 pAb (ATL-HPA021632)

Atlas Antibodies

Catalog No.: ATL-HPA021632-25

Protein Description: cytochrome b5 domain containing 1
Gene Name: CYB5D1
Alternative Gene Name: FLJ32499
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032889: 83%, ENSRNOG00000045742: 85%
Entrez Gene ID: 124637
Uniprot ID: Q6P9G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVAQHNRPEDLWVSYLGRVYDLTSLAQEYKGNLLLKPIVEVAGQDISHWFDPKTRDIRKHIDPLT
• Gene Sequence: EVAQHNRPEDLWVSYLGRVYDLTSLAQEYKGNLLLKPIVEVAGQDISHWFDPKTRDIRKHIDPLT
• Gene ID - Mouse: ENSMUSG00000032889
• Gene ID - Rat: ENSRNOG00000045742
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.