Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA007893-25

• 
• 
• 

Protein Description: cytochrome b5 type B (outer mitochondrial membrane)
Gene Name: CYB5B
Alternative Gene Name: CYB5-M
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031924: 82%, ENSRNOG00000011142: 79%
Entrez Gene ID: 80777
Uniprot ID: O43169
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD
• Gene Sequence: EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD
• Gene ID - Mouse: ENSMUSG00000031924
• Gene ID - Rat: ENSRNOG00000011142
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CYB5B pAb (ATL-HPA007893 w/enhanced validation) – 3 Found

Neve, Etienne P A; Nordling, Asa; Andersson, Tommy B; Hellman, Ulf; Diczfalusy, Ulf; Johansson, Inger; Ingelman-Sundberg, Magnus. Amidoxime reductase system containing cytochrome b5 type B (CYB5B) and MOSC2 is of importance for lipid synthesis in adipocyte mitochondria. The Journal Of Biological Chemistry. 2012;287(9):6307-17. 

Jakobs, Heyka H; Mikula, Michal; Havemeyer, Antje; Strzalkowska, Adriana; Borowa-Chmielak, Monika; Dzwonek, Artur; Gajewska, Marta; Hennig, Ewa E; Ostrowski, Jerzy; Clement, Bernd. The N-reductive system composed of mitochondrial amidoxime reducing component (mARC), cytochrome b5 (CYB5B) and cytochrome b5 reductase (CYB5R) is regulated by fasting and high fat diet in mice. Plos One. 9(8):e105371. 

Rixen, Sophia; Havemeyer, Antje; Tyl-Bielicka, Anita; Pysniak, Kazimiera; Gajewska, Marta; Kulecka, Maria; Ostrowski, Jerzy; Mikula, Michal; Clement, Bernd. Mitochondrial amidoxime-reducing component 2 (MARC2) has a significant role in N-reductive activity and energy metabolism. The Journal Of Biological Chemistry. 2019;294(46):17593-17602.