Anti CYB561D1 pAb (ATL-HPA027028)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027028-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CYB561D1
Alternative Gene Name: FLJ39035, FLJ44753
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037674: 30%, ENSRNOG00000060367: 30%
Entrez Gene ID: 284613
Uniprot ID: Q8N8Q1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSASAWLKPSYSSHLNTPCSSSAPEKHGSGSTGQGRP |
Gene Sequence | MEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSASAWLKPSYSSHLNTPCSSSAPEKHGSGSTGQGRP |
Gene ID - Mouse | ENSMUSG00000037674 |
Gene ID - Rat | ENSRNOG00000060367 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CYB561D1 pAb (ATL-HPA027028) | |
Datasheet | Anti CYB561D1 pAb (ATL-HPA027028) Datasheet (External Link) |
Vendor Page | Anti CYB561D1 pAb (ATL-HPA027028) at Atlas Antibodies |
Documents & Links for Anti CYB561D1 pAb (ATL-HPA027028) | |
Datasheet | Anti CYB561D1 pAb (ATL-HPA027028) Datasheet (External Link) |
Vendor Page | Anti CYB561D1 pAb (ATL-HPA027028) |