Anti CYB561D1 pAb (ATL-HPA027028)

Atlas Antibodies

Catalog No.:
ATL-HPA027028-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cytochrome b561 family, member D1
Gene Name: CYB561D1
Alternative Gene Name: FLJ39035, FLJ44753
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037674: 30%, ENSRNOG00000060367: 30%
Entrez Gene ID: 284613
Uniprot ID: Q8N8Q1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSASAWLKPSYSSHLNTPCSSSAPEKHGSGSTGQGRP
Gene Sequence MEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSASAWLKPSYSSHLNTPCSSSAPEKHGSGSTGQGRP
Gene ID - Mouse ENSMUSG00000037674
Gene ID - Rat ENSRNOG00000060367
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYB561D1 pAb (ATL-HPA027028)
Datasheet Anti CYB561D1 pAb (ATL-HPA027028) Datasheet (External Link)
Vendor Page Anti CYB561D1 pAb (ATL-HPA027028) at Atlas Antibodies

Documents & Links for Anti CYB561D1 pAb (ATL-HPA027028)
Datasheet Anti CYB561D1 pAb (ATL-HPA027028) Datasheet (External Link)
Vendor Page Anti CYB561D1 pAb (ATL-HPA027028)