Anti CYB561D1 pAb (ATL-HPA027028)

Atlas Antibodies

SKU: ATL-HPA027028-25

• 
• 

Protein Description: cytochrome b561 family, member D1
Gene Name: CYB561D1
Alternative Gene Name: FLJ39035, FLJ44753
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037674: 30%, ENSRNOG00000060367: 30%
Entrez Gene ID: 284613
Uniprot ID: Q8N8Q1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSASAWLKPSYSSHLNTPCSSSAPEKHGSGSTGQGRP
• Gene Sequence: MEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSASAWLKPSYSSHLNTPCSSSAPEKHGSGSTGQGRP
• Gene ID - Mouse: ENSMUSG00000037674
• Gene ID - Rat: ENSRNOG00000060367
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.