Anti CXXC5 pAb (ATL-HPA058148)

Atlas Antibodies

Catalog No.:
ATL-HPA058148-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: CXXC finger protein 5
Gene Name: CXXC5
Alternative Gene Name: HSPC195, RINF, WID
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046668: 100%, ENSRNOG00000032878: 100%
Entrez Gene ID: 51523
Uniprot ID: Q7LFL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASLLANGHDLAAAMAVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQSTEMLKRVVQEHLPL
Gene Sequence ASLLANGHDLAAAMAVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQSTEMLKRVVQEHLPL
Gene ID - Mouse ENSMUSG00000046668
Gene ID - Rat ENSRNOG00000032878
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CXXC5 pAb (ATL-HPA058148)
Datasheet Anti CXXC5 pAb (ATL-HPA058148) Datasheet (External Link)
Vendor Page Anti CXXC5 pAb (ATL-HPA058148) at Atlas Antibodies

Documents & Links for Anti CXXC5 pAb (ATL-HPA058148)
Datasheet Anti CXXC5 pAb (ATL-HPA058148) Datasheet (External Link)
Vendor Page Anti CXXC5 pAb (ATL-HPA058148)