Anti CXXC4 pAb (ATL-HPA036600)

Atlas Antibodies

SKU:
ATL-HPA036600-25
  • Immunohistochemical staining of human cerebellum shows moderat cytoplsmic positivity in cells in granular layer.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CXXC finger protein 4
Gene Name: CXXC4
Alternative Gene Name: IDAX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044365: 98%, ENSRNOG00000045764: 98%
Entrez Gene ID: 80319
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSRTSMHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAE
Gene Sequence GSRTSMHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAE
Gene ID - Mouse ENSMUSG00000044365
Gene ID - Rat ENSRNOG00000045764
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CXXC4 pAb (ATL-HPA036600)
Datasheet Anti CXXC4 pAb (ATL-HPA036600) Datasheet (External Link)
Vendor Page Anti CXXC4 pAb (ATL-HPA036600) at Atlas Antibodies

Documents & Links for Anti CXXC4 pAb (ATL-HPA036600)
Datasheet Anti CXXC4 pAb (ATL-HPA036600) Datasheet (External Link)
Vendor Page Anti CXXC4 pAb (ATL-HPA036600)