Anti CXorf67 pAb (ATL-HPA004003 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA004003-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome X open reading frame 67
Gene Name: CXorf67
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093908: 26%, ENSRNOG00000033202: 27%
Entrez Gene ID: 340602
Uniprot ID: Q86X51
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVSSQASPSGGAALSSSTAGSSAAAATSAAIFITDEASGLPIIAAVLTERHSDRQDCRSPHEVFGCVVPEGGSQAAVGPQKATGHADEHLAQTKSPGNSRRRKQPCRNQAAPAQKPPGRRLFPEPLPPSSPGFRPSSYPCSGAST
Gene Sequence TVSSQASPSGGAALSSSTAGSSAAAATSAAIFITDEASGLPIIAAVLTERHSDRQDCRSPHEVFGCVVPEGGSQAAVGPQKATGHADEHLAQTKSPGNSRRRKQPCRNQAAPAQKPPGRRLFPEPLPPSSPGFRPSSYPCSGAST
Gene ID - Mouse ENSMUSG00000093908
Gene ID - Rat ENSRNOG00000033202
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CXorf67 pAb (ATL-HPA004003 w/enhanced validation)
Datasheet Anti CXorf67 pAb (ATL-HPA004003 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CXorf67 pAb (ATL-HPA004003 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CXorf67 pAb (ATL-HPA004003 w/enhanced validation)
Datasheet Anti CXorf67 pAb (ATL-HPA004003 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CXorf67 pAb (ATL-HPA004003 w/enhanced validation)
Citations for Anti CXorf67 pAb (ATL-HPA004003 w/enhanced validation) – 3 Found
Jain, Siddhant U; Do, Truman J; Lund, Peder J; Rashoff, Andrew Q; Diehl, Katharine L; Cieslik, Marcin; Bajic, Andrea; Juretic, Nikoleta; Deshmukh, Shriya; Venneti, Sriram; Muir, Tom W; Garcia, Benjamin A; Jabado, Nada; Lewis, Peter W. PFA ependymoma-associated protein EZHIP inhibits PRC2 activity through a H3 K27M-like mechanism. Nature Communications. 2019;10(1):2146.  PubMed
Piunti, Andrea; Smith, Edwin R; Morgan, Marc A J; Ugarenko, Michal; Khaltyan, Natalia; Helmin, Kathryn A; Ryan, Caila A; Murray, David C; Rickels, Ryan A; Yilmaz, Bahar D; Rendleman, Emily J; Savas, Jeffrey N; Singer, Benjamin D; Bulun, Serdar E; Shilatifard, Ali. CATACOMB: An endogenous inducible gene that antagonizes H3K27 methylation activity of Polycomb repressive complex 2 via an H3K27M-like mechanism. Science Advances. 2019;5(7):eaax2887.  PubMed
Ajuyah, Pamela; Mayoh, Chelsea; Lau, Loretta M S; Barahona, Paulette; Wong, Marie; Chambers, Hazel; Valdes-Mora, Fatima; Senapati, Akanksha; Gifford, Andrew J; D'Arcy, Colleen; Hansford, Jordan R; Manoharan, Neevika; Nicholls, Wayne; Williams, Molly M; Wood, Paul J; Cowley, Mark J; Tyrrell, Vanessa; Haber, Michelle; Ekert, Paul G; Ziegler, David S; Khuong-Quang, Dong-Anh. Histone H3-wild type diffuse midline gliomas with H3K27me3 loss are a distinct entity with exclusive EGFR or ACVR1 mutation and differential methylation of homeobox genes. Scientific Reports. 2023;13(1):3775.  PubMed