Anti CXorf65 pAb (ATL-HPA047396)

Atlas Antibodies

Catalog No.:
ATL-HPA047396-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome X open reading frame 65
Gene Name: CXorf65
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092463: 38%, ENSRNOG00000003954: 37%
Entrez Gene ID: 158830
Uniprot ID: A6NEN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTRLENAYRAFVPLLKNPEPWLLVALRIQCDALERRRIQMLKMKEAKKVVIIEPPASVPSKQSGRSDKKKSTRKSPTFRNRPDFRKNKGRQLNKTTKQK
Gene Sequence GTRLENAYRAFVPLLKNPEPWLLVALRIQCDALERRRIQMLKMKEAKKVVIIEPPASVPSKQSGRSDKKKSTRKSPTFRNRPDFRKNKGRQLNKTTKQK
Gene ID - Mouse ENSMUSG00000092463
Gene ID - Rat ENSRNOG00000003954
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CXorf65 pAb (ATL-HPA047396)
Datasheet Anti CXorf65 pAb (ATL-HPA047396) Datasheet (External Link)
Vendor Page Anti CXorf65 pAb (ATL-HPA047396) at Atlas Antibodies

Documents & Links for Anti CXorf65 pAb (ATL-HPA047396)
Datasheet Anti CXorf65 pAb (ATL-HPA047396) Datasheet (External Link)
Vendor Page Anti CXorf65 pAb (ATL-HPA047396)