Anti CXorf58 pAb (ATL-HPA031544)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031544-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CXorf58
Alternative Gene Name: FLJ25444
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021090: 26%, ENSRNOG00000003679: 26%
Entrez Gene ID: 254158
Uniprot ID: Q96LI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FPKSKVTDIMDVVTMQDYVQYRSFFDEAPAFSGGRNNSWRKLNLENIPRTMLMYDIVHYSESGVISNRLRNEMKF |
Gene Sequence | FPKSKVTDIMDVVTMQDYVQYRSFFDEAPAFSGGRNNSWRKLNLENIPRTMLMYDIVHYSESGVISNRLRNEMKF |
Gene ID - Mouse | ENSMUSG00000021090 |
Gene ID - Rat | ENSRNOG00000003679 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CXorf58 pAb (ATL-HPA031544) | |
Datasheet | Anti CXorf58 pAb (ATL-HPA031544) Datasheet (External Link) |
Vendor Page | Anti CXorf58 pAb (ATL-HPA031544) at Atlas Antibodies |
Documents & Links for Anti CXorf58 pAb (ATL-HPA031544) | |
Datasheet | Anti CXorf58 pAb (ATL-HPA031544) Datasheet (External Link) |
Vendor Page | Anti CXorf58 pAb (ATL-HPA031544) |