Anti CXorf58 pAb (ATL-HPA031542)

Atlas Antibodies

Catalog No.:
ATL-HPA031542-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome X open reading frame 58
Gene Name: CXorf58
Alternative Gene Name: FLJ25444
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034575: 24%, ENSRNOG00000008566: 26%
Entrez Gene ID: 254158
Uniprot ID: Q96LI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRIVSEIRGPYLTVQPLYRPYKQQNQVKFLGRRSKQAQMKVEKMRKVYLAKEKNTSEVTEPKTGPSGTKDNYHLHSIF
Gene Sequence LRIVSEIRGPYLTVQPLYRPYKQQNQVKFLGRRSKQAQMKVEKMRKVYLAKEKNTSEVTEPKTGPSGTKDNYHLHSIF
Gene ID - Mouse ENSMUSG00000034575
Gene ID - Rat ENSRNOG00000008566
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CXorf58 pAb (ATL-HPA031542)
Datasheet Anti CXorf58 pAb (ATL-HPA031542) Datasheet (External Link)
Vendor Page Anti CXorf58 pAb (ATL-HPA031542) at Atlas Antibodies

Documents & Links for Anti CXorf58 pAb (ATL-HPA031542)
Datasheet Anti CXorf58 pAb (ATL-HPA031542) Datasheet (External Link)
Vendor Page Anti CXorf58 pAb (ATL-HPA031542)