Anti CXorf58 pAb (ATL-HPA031542)

Atlas Antibodies

Catalog No.: ATL-HPA031542-25

Protein Description: chromosome X open reading frame 58
Gene Name: CXorf58
Alternative Gene Name: FLJ25444
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034575: 24%, ENSRNOG00000008566: 26%
Entrez Gene ID: 254158
Uniprot ID: Q96LI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRIVSEIRGPYLTVQPLYRPYKQQNQVKFLGRRSKQAQMKVEKMRKVYLAKEKNTSEVTEPKTGPSGTKDNYHLHSIF
• Gene Sequence: LRIVSEIRGPYLTVQPLYRPYKQQNQVKFLGRRSKQAQMKVEKMRKVYLAKEKNTSEVTEPKTGPSGTKDNYHLHSIF
• Gene ID - Mouse: ENSMUSG00000034575
• Gene ID - Rat: ENSRNOG00000008566
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.