Anti CXorf57 pAb (ATL-HPA000896)

Atlas Antibodies

SKU:
ATL-HPA000896-25
  • Immunohistochemical staining of human adrenal gland shows moderate membranous and cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome X open reading frame 57
Gene Name: CXorf57
Alternative Gene Name: FLJ10178, FLJ14191
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042498: 77%, ENSRNOG00000011120: 80%
Entrez Gene ID: 55086
Uniprot ID: Q6NSI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TISDRWESQLWREKKFGLIDHLHYSRVYPESIPRKFMFEHRKFLSDQYNSQPAKYVPPEGRPPKLDDFKSARSLGHFEVTILGLNHEIAIDVAFLPMYCPEDIRTSQIDTLLTSMNY
Gene Sequence TISDRWESQLWREKKFGLIDHLHYSRVYPESIPRKFMFEHRKFLSDQYNSQPAKYVPPEGRPPKLDDFKSARSLGHFEVTILGLNHEIAIDVAFLPMYCPEDIRTSQIDTLLTSMNY
Gene ID - Mouse ENSMUSG00000042498
Gene ID - Rat ENSRNOG00000011120
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CXorf57 pAb (ATL-HPA000896)
Datasheet Anti CXorf57 pAb (ATL-HPA000896) Datasheet (External Link)
Vendor Page Anti CXorf57 pAb (ATL-HPA000896) at Atlas Antibodies

Documents & Links for Anti CXorf57 pAb (ATL-HPA000896)
Datasheet Anti CXorf57 pAb (ATL-HPA000896) Datasheet (External Link)
Vendor Page Anti CXorf57 pAb (ATL-HPA000896)