Anti CXorf40B pAb (ATL-HPA060897)

Atlas Antibodies

Catalog No.:
ATL-HPA060897-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome X open reading frame 40B
Gene Name: CXorf40B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045237: 74%, ENSRNOG00000037352: 79%
Entrez Gene ID: 541578
Uniprot ID: Q96DE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWE
Gene Sequence YAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWE
Gene ID - Mouse ENSMUSG00000045237
Gene ID - Rat ENSRNOG00000037352
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CXorf40B pAb (ATL-HPA060897)
Datasheet Anti CXorf40B pAb (ATL-HPA060897) Datasheet (External Link)
Vendor Page Anti CXorf40B pAb (ATL-HPA060897) at Atlas Antibodies

Documents & Links for Anti CXorf40B pAb (ATL-HPA060897)
Datasheet Anti CXorf40B pAb (ATL-HPA060897) Datasheet (External Link)
Vendor Page Anti CXorf40B pAb (ATL-HPA060897)