Anti CXorf36 pAb (ATL-HPA002806)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002806-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CXorf36
Alternative Gene Name: DIA1R, FLJ14103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037358: 83%, ENSRNOG00000008519: 24%
Entrez Gene ID: 79742
Uniprot ID: Q9H7Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLPASSLSSLVPQVRTSYNFGRTFLGLDKCNACIGTSICKKFFKEEIRSDNWLASHLGLPPDSLLSYPANYSDDSKIWRPVEIFRLVSKYQNEISDRRICASASAPKTCSIERVLRKTERFQKWLQAKRLTPDL |
Gene Sequence | SLPASSLSSLVPQVRTSYNFGRTFLGLDKCNACIGTSICKKFFKEEIRSDNWLASHLGLPPDSLLSYPANYSDDSKIWRPVEIFRLVSKYQNEISDRRICASASAPKTCSIERVLRKTERFQKWLQAKRLTPDL |
Gene ID - Mouse | ENSMUSG00000037358 |
Gene ID - Rat | ENSRNOG00000008519 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CXorf36 pAb (ATL-HPA002806) | |
Datasheet | Anti CXorf36 pAb (ATL-HPA002806) Datasheet (External Link) |
Vendor Page | Anti CXorf36 pAb (ATL-HPA002806) at Atlas Antibodies |
Documents & Links for Anti CXorf36 pAb (ATL-HPA002806) | |
Datasheet | Anti CXorf36 pAb (ATL-HPA002806) Datasheet (External Link) |
Vendor Page | Anti CXorf36 pAb (ATL-HPA002806) |