Anti CXorf36 pAb (ATL-HPA002806)

Atlas Antibodies

Catalog No.:
ATL-HPA002806-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome X open reading frame 36
Gene Name: CXorf36
Alternative Gene Name: DIA1R, FLJ14103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037358: 83%, ENSRNOG00000008519: 24%
Entrez Gene ID: 79742
Uniprot ID: Q9H7Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLPASSLSSLVPQVRTSYNFGRTFLGLDKCNACIGTSICKKFFKEEIRSDNWLASHLGLPPDSLLSYPANYSDDSKIWRPVEIFRLVSKYQNEISDRRICASASAPKTCSIERVLRKTERFQKWLQAKRLTPDL
Gene Sequence SLPASSLSSLVPQVRTSYNFGRTFLGLDKCNACIGTSICKKFFKEEIRSDNWLASHLGLPPDSLLSYPANYSDDSKIWRPVEIFRLVSKYQNEISDRRICASASAPKTCSIERVLRKTERFQKWLQAKRLTPDL
Gene ID - Mouse ENSMUSG00000037358
Gene ID - Rat ENSRNOG00000008519
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CXorf36 pAb (ATL-HPA002806)
Datasheet Anti CXorf36 pAb (ATL-HPA002806) Datasheet (External Link)
Vendor Page Anti CXorf36 pAb (ATL-HPA002806) at Atlas Antibodies

Documents & Links for Anti CXorf36 pAb (ATL-HPA002806)
Datasheet Anti CXorf36 pAb (ATL-HPA002806) Datasheet (External Link)
Vendor Page Anti CXorf36 pAb (ATL-HPA002806)