Anti CXCR1 pAb (ATL-HPA031991)

Atlas Antibodies

Catalog No.:
ATL-HPA031991-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chemokine (C-X-C motif) receptor 1
Gene Name: CXCR1
Alternative Gene Name: CD181, CDw128a, CKR-1, CMKAR1, IL8RA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040462: 33%, ENSRNOG00000013581: 31%
Entrez Gene ID: 3577
Uniprot ID: P25024
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
Gene Sequence MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
Gene ID - Mouse ENSMUSG00000040462
Gene ID - Rat ENSRNOG00000013581
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CXCR1 pAb (ATL-HPA031991)
Datasheet Anti CXCR1 pAb (ATL-HPA031991) Datasheet (External Link)
Vendor Page Anti CXCR1 pAb (ATL-HPA031991) at Atlas Antibodies

Documents & Links for Anti CXCR1 pAb (ATL-HPA031991)
Datasheet Anti CXCR1 pAb (ATL-HPA031991) Datasheet (External Link)
Vendor Page Anti CXCR1 pAb (ATL-HPA031991)