Anti CXCR1 pAb (ATL-HPA031991)

Atlas Antibodies

SKU: ATL-HPA031991-25

• 

Protein Description: chemokine (C-X-C motif) receptor 1
Gene Name: CXCR1
Alternative Gene Name: CD181, CDw128a, CKR-1, CMKAR1, IL8RA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040462: 33%, ENSRNOG00000013581: 31%
Entrez Gene ID: 3577
Uniprot ID: P25024
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
• Gene Sequence: MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
• Gene ID - Mouse: ENSMUSG00000040462
• Gene ID - Rat: ENSRNOG00000013581
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.