Anti CXCR1 pAb (ATL-HPA031991)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031991-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CXCR1
Alternative Gene Name: CD181, CDw128a, CKR-1, CMKAR1, IL8RA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040462: 33%, ENSRNOG00000013581: 31%
Entrez Gene ID: 3577
Uniprot ID: P25024
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK |
Gene Sequence | MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK |
Gene ID - Mouse | ENSMUSG00000040462 |
Gene ID - Rat | ENSRNOG00000013581 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CXCR1 pAb (ATL-HPA031991) | |
Datasheet | Anti CXCR1 pAb (ATL-HPA031991) Datasheet (External Link) |
Vendor Page | Anti CXCR1 pAb (ATL-HPA031991) at Atlas Antibodies |
Documents & Links for Anti CXCR1 pAb (ATL-HPA031991) | |
Datasheet | Anti CXCR1 pAb (ATL-HPA031991) Datasheet (External Link) |
Vendor Page | Anti CXCR1 pAb (ATL-HPA031991) |