Anti CXADR pAb (ATL-HPA030411 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030411-25

Protein Description: coxsackie virus and adenovirus receptor
Gene Name: CXADR
Alternative Gene Name: CAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022865: 97%, ENSRNOG00000001557: 88%
Entrez Gene ID: 1525
Uniprot ID: P78310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLS
• Gene Sequence: EVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLS
• Gene ID - Mouse: ENSMUSG00000022865
• Gene ID - Rat: ENSRNOG00000001557
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CXADR pAb (ATL-HPA030411 w/enhanced validation) – 3 Found

Uhlén, Mathias; Oksvold, Per; Älgenäs, Cajsa; Hamsten, Carl; Fagerberg, Linn; Klevebring, Daniel; Lundberg, Emma; Odeberg, Jacob; Pontén, Fredrik; Kondo, Tadashi; Sivertsson, Åsa. Antibody-based protein profiling of the human chromosome 21. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013458. 

Shien, Kazuhiko; Tanaka, Norimitsu; Watanabe, Masami; Soh, Junichi; Sakaguchi, Masakiyo; Matsuo, Keitaro; Yamamoto, Hiromasa; Furukawa, Masashi; Asano, Hiroaki; Tsukuda, Kazunori; Nasu, Yasutomo; Huh, Nam-Ho; Miyoshi, Shinichiro; Kumon, Hiromi; Toyooka, Shinichi. Anti-cancer effects of REIC/Dkk-3-encoding adenoviral vector for the treatment of non-small cell lung cancer. Plos One. 9(2):e87900. 

Schell, Christoph; Kretz, Oliver; Bregenzer, Andreas; Rogg, Manuel; Helmstädter, Martin; Lisewski, Ulrike; Gotthardt, Michael; Tharaux, Pierre-Louis; Huber, Tobias B; Grahammer, Florian. Podocyte-Specific Deletion of Murine CXADR Does Not Impair Podocyte Development, Function or Stress Response. Plos One. 10(6):e0129424.