Anti CXADR pAb (ATL-HPA030411 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030411-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CXADR
Alternative Gene Name: CAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022865: 97%, ENSRNOG00000001557: 88%
Entrez Gene ID: 1525
Uniprot ID: P78310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLS |
| Gene Sequence | EVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLS |
| Gene ID - Mouse | ENSMUSG00000022865 |
| Gene ID - Rat | ENSRNOG00000001557 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CXADR pAb (ATL-HPA030411 w/enhanced validation) | |
| Datasheet | Anti CXADR pAb (ATL-HPA030411 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CXADR pAb (ATL-HPA030411 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CXADR pAb (ATL-HPA030411 w/enhanced validation) | |
| Datasheet | Anti CXADR pAb (ATL-HPA030411 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CXADR pAb (ATL-HPA030411 w/enhanced validation) |
| Citations for Anti CXADR pAb (ATL-HPA030411 w/enhanced validation) – 3 Found |
| Uhlén, Mathias; Oksvold, Per; Älgenäs, Cajsa; Hamsten, Carl; Fagerberg, Linn; Klevebring, Daniel; Lundberg, Emma; Odeberg, Jacob; Pontén, Fredrik; Kondo, Tadashi; Sivertsson, Åsa. Antibody-based protein profiling of the human chromosome 21. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013458. PubMed |
| Shien, Kazuhiko; Tanaka, Norimitsu; Watanabe, Masami; Soh, Junichi; Sakaguchi, Masakiyo; Matsuo, Keitaro; Yamamoto, Hiromasa; Furukawa, Masashi; Asano, Hiroaki; Tsukuda, Kazunori; Nasu, Yasutomo; Huh, Nam-Ho; Miyoshi, Shinichiro; Kumon, Hiromi; Toyooka, Shinichi. Anti-cancer effects of REIC/Dkk-3-encoding adenoviral vector for the treatment of non-small cell lung cancer. Plos One. 9(2):e87900. PubMed |
| Schell, Christoph; Kretz, Oliver; Bregenzer, Andreas; Rogg, Manuel; Helmstädter, Martin; Lisewski, Ulrike; Gotthardt, Michael; Tharaux, Pierre-Louis; Huber, Tobias B; Grahammer, Florian. Podocyte-Specific Deletion of Murine CXADR Does Not Impair Podocyte Development, Function or Stress Response. Plos One. 10(6):e0129424. PubMed |