Anti CXADR pAb (ATL-HPA003342)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003342-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CXADR
Alternative Gene Name: CAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022865: 91%, ENSRNOG00000001557: 89%
Entrez Gene ID: 1525
Uniprot ID: P78310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKI |
| Gene Sequence | ITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKI |
| Gene ID - Mouse | ENSMUSG00000022865 |
| Gene ID - Rat | ENSRNOG00000001557 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CXADR pAb (ATL-HPA003342) | |
| Datasheet | Anti CXADR pAb (ATL-HPA003342) Datasheet (External Link) |
| Vendor Page | Anti CXADR pAb (ATL-HPA003342) at Atlas Antibodies |
| Documents & Links for Anti CXADR pAb (ATL-HPA003342) | |
| Datasheet | Anti CXADR pAb (ATL-HPA003342) Datasheet (External Link) |
| Vendor Page | Anti CXADR pAb (ATL-HPA003342) |
| Citations for Anti CXADR pAb (ATL-HPA003342) – 5 Found |
| Zussy, Charleine; Loustalot, Fabien; Junyent, Felix; Gardoni, Fabrizio; Bories, Cyril; Valero, Jorge; Desarménien, Michel G; Bernex, Florence; Henaff, Daniel; Bayo-Puxan, Neus; Chen, Jin-Wen; Lonjon, Nicolas; de Koninck, Yves; Malva, João O; Bergelson, Jeffrey M; di Luca, Monica; Schiavo, Giampietro; Salinas, Sara; Kremer, Eric J. Coxsackievirus Adenovirus Receptor Loss Impairs Adult Neurogenesis, Synapse Content, and Hippocampus Plasticity. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2016;36(37):9558-71. PubMed |
| Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. PubMed |
| Vincent, Theresa; Neve, Etienne P A; Johnson, Jill R; Kukalev, Alexander; Rojo, Federico; Albanell, Joan; Pietras, Kristian; Virtanen, Ismo; Philipson, Lennart; Leopold, Philip L; Crystal, Ronald G; de Herreros, Antonio Garcia; Moustakas, Aristidis; Pettersson, Ralf F; Fuxe, Jonas. A SNAIL1-SMAD3/4 transcriptional repressor complex promotes TGF-beta mediated epithelial-mesenchymal transition. Nature Cell Biology. 2009;11(8):943-50. PubMed |
| Kwon, Jeongwoo; Jeong, Sung-min; Choi, Inchul; Kim, Nam-Hyung. ADAM10 Is Involved in Cell Junction Assembly in Early Porcine Embryo Development. Plos One. 11(4):e0152921. PubMed |
| Kawada, Manabu; Inoue, Hiroyuki; Kajikawa, Masunori; Sugiura, Masahito; Sakamoto, Shuichi; Urano, Sakiko; Karasawa, Chigusa; Usami, Ihomi; Futakuchi, Mitsuru; Masuda, Tohru. A novel monoclonal antibody targeting coxsackie virus and adenovirus receptor inhibits tumor growth in vivo. Scientific Reports. 2017;7( 28074864):40400. PubMed |