Anti CX3CR1 pAb (ATL-HPA077743)

Atlas Antibodies

Catalog No.:
ATL-HPA077743-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: C-X3-C motif chemokine receptor 1
Gene Name: CX3CR1
Alternative Gene Name: CCRL1, CMKBRL1, CMKDR1, GPR13, V28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052336: 67%, ENSRNOG00000018509: 65%
Entrez Gene ID: 1524
Uniprot ID: P49238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDA
Gene Sequence HLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDA
Gene ID - Mouse ENSMUSG00000052336
Gene ID - Rat ENSRNOG00000018509
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CX3CR1 pAb (ATL-HPA077743)
Datasheet Anti CX3CR1 pAb (ATL-HPA077743) Datasheet (External Link)
Vendor Page Anti CX3CR1 pAb (ATL-HPA077743) at Atlas Antibodies

Documents & Links for Anti CX3CR1 pAb (ATL-HPA077743)
Datasheet Anti CX3CR1 pAb (ATL-HPA077743) Datasheet (External Link)
Vendor Page Anti CX3CR1 pAb (ATL-HPA077743)