Anti CX3CR1 pAb (ATL-HPA077743)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077743-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CX3CR1
Alternative Gene Name: CCRL1, CMKBRL1, CMKDR1, GPR13, V28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052336: 67%, ENSRNOG00000018509: 65%
Entrez Gene ID: 1524
Uniprot ID: P49238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDA |
Gene Sequence | HLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDA |
Gene ID - Mouse | ENSMUSG00000052336 |
Gene ID - Rat | ENSRNOG00000018509 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CX3CR1 pAb (ATL-HPA077743) | |
Datasheet | Anti CX3CR1 pAb (ATL-HPA077743) Datasheet (External Link) |
Vendor Page | Anti CX3CR1 pAb (ATL-HPA077743) at Atlas Antibodies |
Documents & Links for Anti CX3CR1 pAb (ATL-HPA077743) | |
Datasheet | Anti CX3CR1 pAb (ATL-HPA077743) Datasheet (External Link) |
Vendor Page | Anti CX3CR1 pAb (ATL-HPA077743) |