Anti CX3CR1 pAb (ATL-HPA046587)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046587-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CX3CR1
Alternative Gene Name: CCRL1, CMKBRL1, CMKDR1, GPR13, V28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052336: 38%, ENSRNOG00000018509: 38%
Entrez Gene ID: 1524
Uniprot ID: P49238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LEAFKLADLDFRKSSLASGWRMASGAFTMDQFPESVTENFEYDDLAEACYIGDIVVFGTVF |
| Gene Sequence | LEAFKLADLDFRKSSLASGWRMASGAFTMDQFPESVTENFEYDDLAEACYIGDIVVFGTVF |
| Gene ID - Mouse | ENSMUSG00000052336 |
| Gene ID - Rat | ENSRNOG00000018509 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CX3CR1 pAb (ATL-HPA046587) | |
| Datasheet | Anti CX3CR1 pAb (ATL-HPA046587) Datasheet (External Link) |
| Vendor Page | Anti CX3CR1 pAb (ATL-HPA046587) at Atlas Antibodies |
| Documents & Links for Anti CX3CR1 pAb (ATL-HPA046587) | |
| Datasheet | Anti CX3CR1 pAb (ATL-HPA046587) Datasheet (External Link) |
| Vendor Page | Anti CX3CR1 pAb (ATL-HPA046587) |