Anti CX3CL1 pAb (ATL-HPA040361)
Atlas Antibodies
- SKU:
- ATL-HPA040361-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CX3CL1
Alternative Gene Name: ABCD-3, C3Xkine, CXC3, CXC3C, fractalkine, neurotactin, NTN, SCYD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031778: 66%, ENSRNOG00000016326: 69%
Entrez Gene ID: 6376
Uniprot ID: P78423
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE |
Gene Sequence | GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE |
Gene ID - Mouse | ENSMUSG00000031778 |
Gene ID - Rat | ENSRNOG00000016326 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CX3CL1 pAb (ATL-HPA040361) | |
Datasheet | Anti CX3CL1 pAb (ATL-HPA040361) Datasheet (External Link) |
Vendor Page | Anti CX3CL1 pAb (ATL-HPA040361) at Atlas Antibodies |
Documents & Links for Anti CX3CL1 pAb (ATL-HPA040361) | |
Datasheet | Anti CX3CL1 pAb (ATL-HPA040361) Datasheet (External Link) |
Vendor Page | Anti CX3CL1 pAb (ATL-HPA040361) |
Citations for Anti CX3CL1 pAb (ATL-HPA040361) – 2 Found |
Zsiros, Emese; Duttagupta, Priyanka; Dangaj, Denarda; Li, Hongzhe; Frank, Renee; Garrabrant, Thomas; Hagemann, Ian S; Levine, Bruce L; June, Carl H; Zhang, Lin; Wang, Ena; Marincola, Francesco M; Bedognetti, Davide; Powell, Daniel J Jr; Tanyi, Janos; Feldman, Michael D; Kandalaft, Lana E; Coukos, George. The Ovarian Cancer Chemokine Landscape Is Conducive to Homing of Vaccine-Primed and CD3/CD28-Costimulated T Cells Prepared for Adoptive Therapy. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2015;21(12):2840-50. PubMed |
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |