Anti CWH43 pAb (ATL-HPA042814)

Atlas Antibodies

Catalog No.:
ATL-HPA042814-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cell wall biogenesis 43 C-terminal homolog (S. cerevisiae)
Gene Name: CWH43
Alternative Gene Name: CWH43-C, FLJ21511
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029154: 92%, ENSRNOG00000002174: 90%
Entrez Gene ID: 80157
Uniprot ID: Q9H720
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNVKDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKEGHNYENNHHFHMNTPKYF
Gene Sequence GNVKDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKEGHNYENNHHFHMNTPKYF
Gene ID - Mouse ENSMUSG00000029154
Gene ID - Rat ENSRNOG00000002174
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CWH43 pAb (ATL-HPA042814)
Datasheet Anti CWH43 pAb (ATL-HPA042814) Datasheet (External Link)
Vendor Page Anti CWH43 pAb (ATL-HPA042814) at Atlas Antibodies

Documents & Links for Anti CWH43 pAb (ATL-HPA042814)
Datasheet Anti CWH43 pAb (ATL-HPA042814) Datasheet (External Link)
Vendor Page Anti CWH43 pAb (ATL-HPA042814)
Citations for Anti CWH43 pAb (ATL-HPA042814) – 1 Found
Yang, Hong Wei; Lee, Semin; Yang, Dejun; Dai, Huijun; Zhang, Yan; Han, Lei; Zhao, Sijun; Zhang, Shuo; Ma, Yan; Johnson, Marciana F; Rattray, Anna K; Johnson, Tatyana A; Wang, George; Zheng, Shaokuan; Carroll, Rona S; Park, Peter J; Johnson, Mark D. Deletions in CWH43 cause idiopathic normal pressure hydrocephalus. Embo Molecular Medicine. 2021;13(3):e13249.  PubMed