Anti CWH43 pAb (ATL-HPA042814)

Atlas Antibodies

Catalog No.: ATL-HPA042814-25

Protein Description: cell wall biogenesis 43 C-terminal homolog (S. cerevisiae)
Gene Name: CWH43
Alternative Gene Name: CWH43-C, FLJ21511
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029154: 92%, ENSRNOG00000002174: 90%
Entrez Gene ID: 80157
Uniprot ID: Q9H720
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNVKDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKEGHNYENNHHFHMNTPKYF
• Gene Sequence: GNVKDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKEGHNYENNHHFHMNTPKYF
• Gene ID - Mouse: ENSMUSG00000029154
• Gene ID - Rat: ENSRNOG00000002174
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CWH43 pAb (ATL-HPA042814) – 1 Found

Yang, Hong Wei; Lee, Semin; Yang, Dejun; Dai, Huijun; Zhang, Yan; Han, Lei; Zhao, Sijun; Zhang, Shuo; Ma, Yan; Johnson, Marciana F; Rattray, Anna K; Johnson, Tatyana A; Wang, George; Zheng, Shaokuan; Carroll, Rona S; Park, Peter J; Johnson, Mark D. Deletions in CWH43 cause idiopathic normal pressure hydrocephalus. Embo Molecular Medicine. 2021;13(3):e13249.