Anti CWH43 pAb (ATL-HPA042814)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042814-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CWH43
Alternative Gene Name: CWH43-C, FLJ21511
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029154: 92%, ENSRNOG00000002174: 90%
Entrez Gene ID: 80157
Uniprot ID: Q9H720
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GNVKDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKEGHNYENNHHFHMNTPKYF |
| Gene Sequence | GNVKDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKEGHNYENNHHFHMNTPKYF |
| Gene ID - Mouse | ENSMUSG00000029154 |
| Gene ID - Rat | ENSRNOG00000002174 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CWH43 pAb (ATL-HPA042814) | |
| Datasheet | Anti CWH43 pAb (ATL-HPA042814) Datasheet (External Link) |
| Vendor Page | Anti CWH43 pAb (ATL-HPA042814) at Atlas Antibodies |
| Documents & Links for Anti CWH43 pAb (ATL-HPA042814) | |
| Datasheet | Anti CWH43 pAb (ATL-HPA042814) Datasheet (External Link) |
| Vendor Page | Anti CWH43 pAb (ATL-HPA042814) |
| Citations for Anti CWH43 pAb (ATL-HPA042814) – 1 Found |
| Yang, Hong Wei; Lee, Semin; Yang, Dejun; Dai, Huijun; Zhang, Yan; Han, Lei; Zhao, Sijun; Zhang, Shuo; Ma, Yan; Johnson, Marciana F; Rattray, Anna K; Johnson, Tatyana A; Wang, George; Zheng, Shaokuan; Carroll, Rona S; Park, Peter J; Johnson, Mark D. Deletions in CWH43 cause idiopathic normal pressure hydrocephalus. Embo Molecular Medicine. 2021;13(3):e13249. PubMed |