Anti CWC27 pAb (ATL-HPA024149)

Atlas Antibodies

Catalog No.:
ATL-HPA024149-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CWC27 spliceosome-associated protein homolog (S. cerevisiae)
Gene Name: CWC27
Alternative Gene Name: NY-CO-10, SDCCAG10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021715: 91%, ENSRNOG00000013252: 88%
Entrez Gene ID: 10283
Uniprot ID: Q6UX04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEKGDAPDLVDDGEDESA
Gene Sequence EEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEKGDAPDLVDDGEDESA
Gene ID - Mouse ENSMUSG00000021715
Gene ID - Rat ENSRNOG00000013252
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CWC27 pAb (ATL-HPA024149)
Datasheet Anti CWC27 pAb (ATL-HPA024149) Datasheet (External Link)
Vendor Page Anti CWC27 pAb (ATL-HPA024149) at Atlas Antibodies

Documents & Links for Anti CWC27 pAb (ATL-HPA024149)
Datasheet Anti CWC27 pAb (ATL-HPA024149) Datasheet (External Link)
Vendor Page Anti CWC27 pAb (ATL-HPA024149)