Anti CWC15 pAb (ATL-HPA039878)

Atlas Antibodies

Catalog No.:
ATL-HPA039878-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: CWC15 spliceosome-associated protein
Gene Name: CWC15
Alternative Gene Name: AD002, C11orf5, Cwf15, HSPC148
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004096: 99%, ENSRNOG00000008490: 100%
Entrez Gene ID: 51503
Uniprot ID: Q9P013
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVS
Gene Sequence RGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVS
Gene ID - Mouse ENSMUSG00000004096
Gene ID - Rat ENSRNOG00000008490
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CWC15 pAb (ATL-HPA039878)
Datasheet Anti CWC15 pAb (ATL-HPA039878) Datasheet (External Link)
Vendor Page Anti CWC15 pAb (ATL-HPA039878) at Atlas Antibodies

Documents & Links for Anti CWC15 pAb (ATL-HPA039878)
Datasheet Anti CWC15 pAb (ATL-HPA039878) Datasheet (External Link)
Vendor Page Anti CWC15 pAb (ATL-HPA039878)