Anti CWC15 pAb (ATL-HPA039878)

Atlas Antibodies

Catalog No.: ATL-HPA039878-25

Protein Description: CWC15 spliceosome-associated protein
Gene Name: CWC15
Alternative Gene Name: AD002, C11orf5, Cwf15, HSPC148
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004096: 99%, ENSRNOG00000008490: 100%
Entrez Gene ID: 51503
Uniprot ID: Q9P013
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVS
• Gene Sequence: RGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVS
• Gene ID - Mouse: ENSMUSG00000004096
• Gene ID - Rat: ENSRNOG00000008490
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.