Anti CUX1 pAb (ATL-HPA003277)

Atlas Antibodies

Catalog No.:
ATL-HPA003277-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cut-like homeobox 1
Gene Name: CUX1
Alternative Gene Name: CASP, CDP, CDP/Cut, CDP/Cux, CDP1, Clox, CUT, CUTL1, CUX, Cux/CDP, GOLIM6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029705: 72%, ENSRNOG00000001424: 74%
Entrez Gene ID: 1523
Uniprot ID: P39880
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS
Gene Sequence LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS
Gene ID - Mouse ENSMUSG00000029705
Gene ID - Rat ENSRNOG00000001424
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CUX1 pAb (ATL-HPA003277)
Datasheet Anti CUX1 pAb (ATL-HPA003277) Datasheet (External Link)
Vendor Page Anti CUX1 pAb (ATL-HPA003277) at Atlas Antibodies

Documents & Links for Anti CUX1 pAb (ATL-HPA003277)
Datasheet Anti CUX1 pAb (ATL-HPA003277) Datasheet (External Link)
Vendor Page Anti CUX1 pAb (ATL-HPA003277)
Citations for Anti CUX1 pAb (ATL-HPA003277) – 2 Found
Schlagal, Caitlin R; Dunn, Tiffany J; Xu, Pei; Felsing, Daniel E; Merritt, Christina R; Manja, Sanjana; Fox, Robert G; Buffington, Shelly A; Saade, George; Dineley, Kelly T; Yu, Yongjia; Cunningham, Kathryn A; Wu, Ping. Maternal Opioid Exposure Culminates in Perturbed Murine Neurodevelopment and Hyperactive Phenotype in Adolescence. Neuroscience. 2021;463( 33811940):272-287.  PubMed
Stutz, Bernardo; Waterson, Michael J; Šestan-Peša, Matija; Dietrich, Marcelo O; Škarica, Mario; Sestan, Nenad; Racz, Bence; Magyar, Aletta; Sotonyi, Peter; Liu, Zhong-Wu; Gao, Xiao-Bing; Matyas, Ferenc; Stoiljkovic, Milan; Horvath, Tamas L. AgRP neurons control structure and function of the medial prefrontal cortex. Molecular Psychiatry. 2022;27(10):3951-3960.  PubMed