Anti CUTC pAb (ATL-HPA058231)

Atlas Antibodies

Catalog No.:
ATL-HPA058231-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cutC copper transporter
Gene Name: CUTC
Alternative Gene Name: CGI-32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025193: 96%, ENSRNOG00000017298: 86%
Entrez Gene ID: 51076
Uniprot ID: Q9NTM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCD
Gene Sequence RLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCD
Gene ID - Mouse ENSMUSG00000025193
Gene ID - Rat ENSRNOG00000017298
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CUTC pAb (ATL-HPA058231)
Datasheet Anti CUTC pAb (ATL-HPA058231) Datasheet (External Link)
Vendor Page Anti CUTC pAb (ATL-HPA058231) at Atlas Antibodies

Documents & Links for Anti CUTC pAb (ATL-HPA058231)
Datasheet Anti CUTC pAb (ATL-HPA058231) Datasheet (External Link)
Vendor Page Anti CUTC pAb (ATL-HPA058231)