Anti CUTC pAb (ATL-HPA038619 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038619-25

• 
• 
• 

Protein Description: cutC copper transporter
Gene Name: CUTC
Alternative Gene Name: CGI-32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025193: 92%, ENSRNOG00000017298: 94%
Entrez Gene ID: 51076
Uniprot ID: Q9NTM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADI
• Gene Sequence: KRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADI
• Gene ID - Mouse: ENSMUSG00000025193
• Gene ID - Rat: ENSRNOG00000017298
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.