Anti CUL7 pAb (ATL-HPA030096)

Atlas Antibodies

SKU: ATL-HPA030096-25

• 

Protein Description: cullin 7
Gene Name: CUL7
Alternative Gene Name: dJ20C7.5, KIAA0076
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038545: 89%, ENSRNOG00000017857: 90%
Entrez Gene ID: 9820
Uniprot ID: Q14999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVGALDKSVLEEMETDVKSLIQRALRQLEECVGTIPPAPLLHTVH
• Gene Sequence: CKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVGALDKSVLEEMETDVKSLIQRALRQLEECVGTIPPAPLLHTVH
• Gene ID - Mouse: ENSMUSG00000038545
• Gene ID - Rat: ENSRNOG00000017857
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CUL7 pAb (ATL-HPA030096) – 1 Found

Fahlbusch, Fabian B; Dawood, Yousif; Hartner, Andrea; Menendez-Castro, Carlos; Nögel, Stephanie C; Tzschoppe, Anja; Schneider, Holm; Strissel, Pamela; Beckmann, Matthias W; Schleussner, Ekkehard; Ruebner, Matthias; Dörr, Helmuth G; Schild, Ralf L; Rascher, Wolfgang; Dötsch, Jörg. Cullin 7 and Fbxw 8 expression in trophoblastic cells is regulated via oxygen tension: implications for intrauterine growth restriction?. The Journal Of Maternal-Fetal & Neonatal Medicine : The Official Journal Of The European Association Of Perinatal Medicine, The Federation Of Asia And Oceania Perinatal Societies, The International Society Of Perinatal Obstetricians. 2012;25(11):2209-15.