Anti CUL7 pAb (ATL-HPA030095)

Atlas Antibodies

SKU: ATL-HPA030095-25

• 

Protein Description: cullin 7
Gene Name: CUL7
Alternative Gene Name: dJ20C7.5, KIAA0076
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038545: 51%, ENSRNOG00000017857: 60%
Entrez Gene ID: 9820
Uniprot ID: Q14999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPIELAQDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGNQAYPSLLEAQEDV
• Gene Sequence: FFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPIELAQDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGNQAYPSLLEAQEDV
• Gene ID - Mouse: ENSMUSG00000038545
• Gene ID - Rat: ENSRNOG00000017857
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CUL7 pAb (ATL-HPA030095) – 1 Found

Blondelle, Jordan; Biju, Andrea; Lange, Stephan. The Role of Cullin-RING Ligases in Striated Muscle Development, Function, and Disease. International Journal Of Molecular Sciences. 2020;21(21)