Anti CUL7 pAb (ATL-HPA030095)

Atlas Antibodies

Catalog No.:
ATL-HPA030095-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cullin 7
Gene Name: CUL7
Alternative Gene Name: dJ20C7.5, KIAA0076
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038545: 51%, ENSRNOG00000017857: 60%
Entrez Gene ID: 9820
Uniprot ID: Q14999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPIELAQDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGNQAYPSLLEAQEDV
Gene Sequence FFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPIELAQDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGNQAYPSLLEAQEDV
Gene ID - Mouse ENSMUSG00000038545
Gene ID - Rat ENSRNOG00000017857
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CUL7 pAb (ATL-HPA030095)
Datasheet Anti CUL7 pAb (ATL-HPA030095) Datasheet (External Link)
Vendor Page Anti CUL7 pAb (ATL-HPA030095) at Atlas Antibodies

Documents & Links for Anti CUL7 pAb (ATL-HPA030095)
Datasheet Anti CUL7 pAb (ATL-HPA030095) Datasheet (External Link)
Vendor Page Anti CUL7 pAb (ATL-HPA030095)
Citations for Anti CUL7 pAb (ATL-HPA030095) – 1 Found
Blondelle, Jordan; Biju, Andrea; Lange, Stephan. The Role of Cullin-RING Ligases in Striated Muscle Development, Function, and Disease. International Journal Of Molecular Sciences. 2020;21(21)  PubMed