Anti CUL7 pAb (ATL-HPA030095)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030095-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CUL7
Alternative Gene Name: dJ20C7.5, KIAA0076
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038545: 51%, ENSRNOG00000017857: 60%
Entrez Gene ID: 9820
Uniprot ID: Q14999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPIELAQDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGNQAYPSLLEAQEDV |
| Gene Sequence | FFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPIELAQDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGNQAYPSLLEAQEDV |
| Gene ID - Mouse | ENSMUSG00000038545 |
| Gene ID - Rat | ENSRNOG00000017857 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CUL7 pAb (ATL-HPA030095) | |
| Datasheet | Anti CUL7 pAb (ATL-HPA030095) Datasheet (External Link) |
| Vendor Page | Anti CUL7 pAb (ATL-HPA030095) at Atlas Antibodies |
| Documents & Links for Anti CUL7 pAb (ATL-HPA030095) | |
| Datasheet | Anti CUL7 pAb (ATL-HPA030095) Datasheet (External Link) |
| Vendor Page | Anti CUL7 pAb (ATL-HPA030095) |
| Citations for Anti CUL7 pAb (ATL-HPA030095) – 1 Found |
| Blondelle, Jordan; Biju, Andrea; Lange, Stephan. The Role of Cullin-RING Ligases in Striated Muscle Development, Function, and Disease. International Journal Of Molecular Sciences. 2020;21(21) PubMed |