Anti CUEDC2 pAb (ATL-HPA041829)

Atlas Antibodies

Catalog No.:
ATL-HPA041829-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CUE domain containing 2
Gene Name: CUEDC2
Alternative Gene Name: C10orf66, MGC2491
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036748: 96%, ENSRNOG00000019574: 94%
Entrez Gene ID: 79004
Uniprot ID: Q9H467
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QKDELKSFILQKYMMVDSAEDQKIHRPMAPKEAPKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH
Gene Sequence QKDELKSFILQKYMMVDSAEDQKIHRPMAPKEAPKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH
Gene ID - Mouse ENSMUSG00000036748
Gene ID - Rat ENSRNOG00000019574
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CUEDC2 pAb (ATL-HPA041829)
Datasheet Anti CUEDC2 pAb (ATL-HPA041829) Datasheet (External Link)
Vendor Page Anti CUEDC2 pAb (ATL-HPA041829) at Atlas Antibodies

Documents & Links for Anti CUEDC2 pAb (ATL-HPA041829)
Datasheet Anti CUEDC2 pAb (ATL-HPA041829) Datasheet (External Link)
Vendor Page Anti CUEDC2 pAb (ATL-HPA041829)