Anti CUEDC2 pAb (ATL-HPA036544 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA036544-25
  • Immunohistochemical staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CUEDC2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411416).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CUE domain containing 2
Gene Name: CUEDC2
Alternative Gene Name: C10orf66, MGC2491
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036748: 95%, ENSRNOG00000019574: 75%
Entrez Gene ID: 79004
Uniprot ID: Q9H467
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPI
Gene Sequence DLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPI
Gene ID - Mouse ENSMUSG00000036748
Gene ID - Rat ENSRNOG00000019574
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CUEDC2 pAb (ATL-HPA036544 w/enhanced validation)
Datasheet Anti CUEDC2 pAb (ATL-HPA036544 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CUEDC2 pAb (ATL-HPA036544 w/enhanced validation)