Anti CUEDC1 pAb (ATL-HPA024836 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA024836-25
  • Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuronal cells, endothelial cells and in neuropil.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CUEDC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413433).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CUE domain containing 1
Gene Name: CUEDC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098571: 89%, ENSRNOG00000010257: 89%
Entrez Gene ID: 404093
Uniprot ID: Q9NWM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPGTGDANPAVSEDALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLKHQSLGAAASTANLLDDVEGHACDEDFRGRRQEAPKVEEGLREGQ
Gene Sequence VPGTGDANPAVSEDALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLKHQSLGAAASTANLLDDVEGHACDEDFRGRRQEAPKVEEGLREGQ
Gene ID - Mouse ENSMUSG00000098571
Gene ID - Rat ENSRNOG00000010257
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CUEDC1 pAb (ATL-HPA024836 w/enhanced validation)
Datasheet Anti CUEDC1 pAb (ATL-HPA024836 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CUEDC1 pAb (ATL-HPA024836 w/enhanced validation)