Anti CUBN pAb (ATL-HPA004133 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA004133-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cubilin
Gene Name: CUBN
Alternative Gene Name: gp280, IFCR, MGA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026726: 75%, ENSRNOG00000029047: 76%
Entrez Gene ID: 8029
Uniprot ID: O60494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PNGDSSCNQGDYLVLRNGPDIYSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGNVYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYL
Gene Sequence PNGDSSCNQGDYLVLRNGPDIYSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGNVYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYL
Gene ID - Mouse ENSMUSG00000026726
Gene ID - Rat ENSRNOG00000029047
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CUBN pAb (ATL-HPA004133 w/enhanced validation)
Datasheet Anti CUBN pAb (ATL-HPA004133 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CUBN pAb (ATL-HPA004133 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CUBN pAb (ATL-HPA004133 w/enhanced validation)
Datasheet Anti CUBN pAb (ATL-HPA004133 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CUBN pAb (ATL-HPA004133 w/enhanced validation)
Citations for Anti CUBN pAb (ATL-HPA004133 w/enhanced validation) – 2 Found
Gremel, Gabriela; Djureinovic, Dijana; Niinivirta, Marjut; Laird, Alexander; Ljungqvist, Oscar; Johannesson, Henrik; Bergman, Julia; Edqvist, Per-Henrik; Navani, Sanjay; Khan, Naila; Patil, Tushar; Sivertsson, Åsa; Uhlén, Mathias; Harrison, David J; Ullenhag, Gustav J; Stewart, Grant D; Pontén, Fredrik. A systematic search strategy identifies cubilin as independent prognostic marker for renal cell carcinoma. Bmc Cancer. 2017;17(1):9.  PubMed
Niinivirta, Marjut; Enblad, Gunilla; Edqvist, Per-Henrik; Pontén, Fredrik; Dragomir, Anca; Ullenhag, Gustav J. Tumoral cubilin is a predictive marker for treatment of renal cancer patients with sunitinib and sorafenib. Journal Of Cancer Research And Clinical Oncology. 2017;143(6):961-970.  PubMed