Anti CUBN pAb (ATL-HPA004133 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004133-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CUBN
Alternative Gene Name: gp280, IFCR, MGA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026726: 75%, ENSRNOG00000029047: 76%
Entrez Gene ID: 8029
Uniprot ID: O60494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PNGDSSCNQGDYLVLRNGPDIYSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGNVYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYL |
| Gene Sequence | PNGDSSCNQGDYLVLRNGPDIYSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGNVYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYL |
| Gene ID - Mouse | ENSMUSG00000026726 |
| Gene ID - Rat | ENSRNOG00000029047 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CUBN pAb (ATL-HPA004133 w/enhanced validation) | |
| Datasheet | Anti CUBN pAb (ATL-HPA004133 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CUBN pAb (ATL-HPA004133 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CUBN pAb (ATL-HPA004133 w/enhanced validation) | |
| Datasheet | Anti CUBN pAb (ATL-HPA004133 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CUBN pAb (ATL-HPA004133 w/enhanced validation) |
| Citations for Anti CUBN pAb (ATL-HPA004133 w/enhanced validation) – 2 Found |
| Gremel, Gabriela; Djureinovic, Dijana; Niinivirta, Marjut; Laird, Alexander; Ljungqvist, Oscar; Johannesson, Henrik; Bergman, Julia; Edqvist, Per-Henrik; Navani, Sanjay; Khan, Naila; Patil, Tushar; Sivertsson, Åsa; Uhlén, Mathias; Harrison, David J; Ullenhag, Gustav J; Stewart, Grant D; Pontén, Fredrik. A systematic search strategy identifies cubilin as independent prognostic marker for renal cell carcinoma. Bmc Cancer. 2017;17(1):9. PubMed |
| Niinivirta, Marjut; Enblad, Gunilla; Edqvist, Per-Henrik; Pontén, Fredrik; Dragomir, Anca; Ullenhag, Gustav J. Tumoral cubilin is a predictive marker for treatment of renal cancer patients with sunitinib and sorafenib. Journal Of Cancer Research And Clinical Oncology. 2017;143(6):961-970. PubMed |