Anti CTU2 pAb (ATL-HPA041135)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041135-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CTU2
Alternative Gene Name: C16orf84, NCS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049482: 69%, ENSRNOG00000051531: 70%
Entrez Gene ID: 348180
Uniprot ID: Q2VPK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSPDSFCLGFSEGAACGQSLEERSKTLAEVKPILQATGFPWHVVALEEVFSLPPSVLWCSAQELVGSEGAYKAAVDSFLQQQH |
Gene Sequence | LSPDSFCLGFSEGAACGQSLEERSKTLAEVKPILQATGFPWHVVALEEVFSLPPSVLWCSAQELVGSEGAYKAAVDSFLQQQH |
Gene ID - Mouse | ENSMUSG00000049482 |
Gene ID - Rat | ENSRNOG00000051531 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CTU2 pAb (ATL-HPA041135) | |
Datasheet | Anti CTU2 pAb (ATL-HPA041135) Datasheet (External Link) |
Vendor Page | Anti CTU2 pAb (ATL-HPA041135) at Atlas Antibodies |
Documents & Links for Anti CTU2 pAb (ATL-HPA041135) | |
Datasheet | Anti CTU2 pAb (ATL-HPA041135) Datasheet (External Link) |
Vendor Page | Anti CTU2 pAb (ATL-HPA041135) |