Anti CTU1 pAb (ATL-HPA053797)

Atlas Antibodies

Catalog No.:
ATL-HPA053797-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cytosolic thiouridylase subunit 1
Gene Name: CTU1
Alternative Gene Name: ATPBD3, MGC17332, NCS6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038888: 93%, ENSRNOG00000018334: 93%
Entrez Gene ID: 90353
Uniprot ID: Q7Z7A3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLR
Gene Sequence RLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLR
Gene ID - Mouse ENSMUSG00000038888
Gene ID - Rat ENSRNOG00000018334
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTU1 pAb (ATL-HPA053797)
Datasheet Anti CTU1 pAb (ATL-HPA053797) Datasheet (External Link)
Vendor Page Anti CTU1 pAb (ATL-HPA053797) at Atlas Antibodies

Documents & Links for Anti CTU1 pAb (ATL-HPA053797)
Datasheet Anti CTU1 pAb (ATL-HPA053797) Datasheet (External Link)
Vendor Page Anti CTU1 pAb (ATL-HPA053797)