Anti CTU1 pAb (ATL-HPA053797)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053797-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CTU1
Alternative Gene Name: ATPBD3, MGC17332, NCS6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038888: 93%, ENSRNOG00000018334: 93%
Entrez Gene ID: 90353
Uniprot ID: Q7Z7A3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLR |
| Gene Sequence | RLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLR |
| Gene ID - Mouse | ENSMUSG00000038888 |
| Gene ID - Rat | ENSRNOG00000018334 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTU1 pAb (ATL-HPA053797) | |
| Datasheet | Anti CTU1 pAb (ATL-HPA053797) Datasheet (External Link) |
| Vendor Page | Anti CTU1 pAb (ATL-HPA053797) at Atlas Antibodies |
| Documents & Links for Anti CTU1 pAb (ATL-HPA053797) | |
| Datasheet | Anti CTU1 pAb (ATL-HPA053797) Datasheet (External Link) |
| Vendor Page | Anti CTU1 pAb (ATL-HPA053797) |