Anti CTTNBP2NL pAb (ATL-HPA007301)

Atlas Antibodies

Catalog No.:
ATL-HPA007301-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: CTTNBP2 N-terminal like
Gene Name: CTTNBP2NL
Alternative Gene Name: DKFZp547A023
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062127: 95%, ENSRNOG00000014479: 98%
Entrez Gene ID: 55917
Uniprot ID: Q9P2B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NPLSILKVVMKQCKNMQERMLSQLAAAESRHRKVILDLEEERQRHAQDTAEGDDVTYMLEKERERLTQQLEFEKSQVKKFEKEQKKLSSQLEEERSRHKQLSSMLVLECKKATNKAAEEGQKAGELSLKLEKEKSRVSKLEEELAAERKR
Gene Sequence NPLSILKVVMKQCKNMQERMLSQLAAAESRHRKVILDLEEERQRHAQDTAEGDDVTYMLEKERERLTQQLEFEKSQVKKFEKEQKKLSSQLEEERSRHKQLSSMLVLECKKATNKAAEEGQKAGELSLKLEKEKSRVSKLEEELAAERKR
Gene ID - Mouse ENSMUSG00000062127
Gene ID - Rat ENSRNOG00000014479
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTTNBP2NL pAb (ATL-HPA007301)
Datasheet Anti CTTNBP2NL pAb (ATL-HPA007301) Datasheet (External Link)
Vendor Page Anti CTTNBP2NL pAb (ATL-HPA007301) at Atlas Antibodies

Documents & Links for Anti CTTNBP2NL pAb (ATL-HPA007301)
Datasheet Anti CTTNBP2NL pAb (ATL-HPA007301) Datasheet (External Link)
Vendor Page Anti CTTNBP2NL pAb (ATL-HPA007301)
Citations for Anti CTTNBP2NL pAb (ATL-HPA007301) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed