Anti CTTN pAb (ATL-HPA057242)

Atlas Antibodies

Catalog No.:
ATL-HPA057242-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: cortactin
Gene Name: CTTN
Alternative Gene Name: EMS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031078: 96%, ENSRNOG00000047280: 97%
Entrez Gene ID: 2017
Uniprot ID: Q14247
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGF
Gene Sequence GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGF
Gene ID - Mouse ENSMUSG00000031078
Gene ID - Rat ENSRNOG00000047280
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTTN pAb (ATL-HPA057242)
Datasheet Anti CTTN pAb (ATL-HPA057242) Datasheet (External Link)
Vendor Page Anti CTTN pAb (ATL-HPA057242) at Atlas Antibodies

Documents & Links for Anti CTTN pAb (ATL-HPA057242)
Datasheet Anti CTTN pAb (ATL-HPA057242) Datasheet (External Link)
Vendor Page Anti CTTN pAb (ATL-HPA057242)