Anti CTSZ pAb (ATL-HPA053504)

Atlas Antibodies

Catalog No.:
ATL-HPA053504-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cathepsin Z
Gene Name: CTSZ
Alternative Gene Name: CTSX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016256: 93%, ENSRNOG00000050697: 93%
Entrez Gene ID: 1522
Uniprot ID: Q9UBR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVW
Gene Sequence VDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVW
Gene ID - Mouse ENSMUSG00000016256
Gene ID - Rat ENSRNOG00000050697
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTSZ pAb (ATL-HPA053504)
Datasheet Anti CTSZ pAb (ATL-HPA053504) Datasheet (External Link)
Vendor Page Anti CTSZ pAb (ATL-HPA053504) at Atlas Antibodies

Documents & Links for Anti CTSZ pAb (ATL-HPA053504)
Datasheet Anti CTSZ pAb (ATL-HPA053504) Datasheet (External Link)
Vendor Page Anti CTSZ pAb (ATL-HPA053504)