Anti CTSS pAb (ATL-HPA002988 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002988-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CTSS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038642: 76%, ENSRNOG00000021157: 78%
Entrez Gene ID: 1520
Uniprot ID: P25774
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCG |
| Gene Sequence | NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCG |
| Gene ID - Mouse | ENSMUSG00000038642 |
| Gene ID - Rat | ENSRNOG00000021157 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTSS pAb (ATL-HPA002988 w/enhanced validation) | |
| Datasheet | Anti CTSS pAb (ATL-HPA002988 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CTSS pAb (ATL-HPA002988 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CTSS pAb (ATL-HPA002988 w/enhanced validation) | |
| Datasheet | Anti CTSS pAb (ATL-HPA002988 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CTSS pAb (ATL-HPA002988 w/enhanced validation) |
| Citations for Anti CTSS pAb (ATL-HPA002988 w/enhanced validation) – 5 Found |
| Wilkinson, Richard D A; Burden, Roberta E; McDowell, Sara H; McArt, Darragh G; McQuaid, Stephen; Bingham, Victoria; Williams, Rich; Cox, Órla T; O'Connor, Rosemary; McCabe, Nuala; Kennedy, Richard D; Buckley, Niamh E; Scott, Christopher J. A Novel Role for Cathepsin S as a Potential Biomarker in Triple Negative Breast Cancer. Journal Of Oncology. 2019( 31346333):3980273. PubMed |
| Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79. PubMed |
| Ma, Yue; Visser, Lydia; Roelofsen, Han; de Vries, Marcel; Diepstra, Arjan; van Imhoff, Gustaaf; van der Wal, Tineke; Luinge, Marjan; Alvarez-Llamas, Gloria; Vos, Hans; Poppema, Sibrand; Vonk, Roel; van den Berg, Anke. Proteomics analysis of Hodgkin lymphoma: identification of new players involved in the cross-talk between HRS cells and infiltrating lymphocytes. Blood. 2008;111(4):2339-46. PubMed |
| Perera, Rushika M; Stoykova, Svetlana; Nicolay, Brandon N; Ross, Kenneth N; Fitamant, Julien; Boukhali, Myriam; Lengrand, Justine; Deshpande, Vikram; Selig, Martin K; Ferrone, Cristina R; Settleman, Jeff; Stephanopoulos, Gregory; Dyson, Nicholas J; Zoncu, Roberto; Ramaswamy, Sridhar; Haas, Wilhelm; Bardeesy, Nabeel. Transcriptional control of autophagy-lysosome function drives pancreatic cancer metabolism. Nature. 2015;524(7565):361-5. PubMed |
| Wu, Jianhua; Wu, Zhuoze; He, Aodi; Zhang, Tongmei; Zhang, Ping; Jin, Jing; Li, Sisi; Li, Gaigai; Li, Xinyan; Liang, Shiqi; Pei, Lei; Liu, Rong; Tian, Qing; He, Ximiao; Lu, Youming; Tang, Zhouping; Li, Hao. Genome-Wide Screen and Validation of Microglia Pro-Inflammatory Mediators in Stroke. Aging And Disease. 2021;12(3):786-800. PubMed |