Anti CTSL pAb (ATL-HPA070413)

Atlas Antibodies

Catalog No.:
ATL-HPA070413-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cathepsin L
Gene Name: CTSL
Alternative Gene Name: CTSL1, FLJ31037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021477: 50%, ENSRNOG00000018566: 53%
Entrez Gene ID: 1514
Uniprot ID: P07711
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIASATLTFDHSLEAQWTKWKAMHNRLYGM
Gene Sequence GIASATLTFDHSLEAQWTKWKAMHNRLYGM
Gene ID - Mouse ENSMUSG00000021477
Gene ID - Rat ENSRNOG00000018566
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTSL pAb (ATL-HPA070413)
Datasheet Anti CTSL pAb (ATL-HPA070413) Datasheet (External Link)
Vendor Page Anti CTSL pAb (ATL-HPA070413) at Atlas Antibodies

Documents & Links for Anti CTSL pAb (ATL-HPA070413)
Datasheet Anti CTSL pAb (ATL-HPA070413) Datasheet (External Link)
Vendor Page Anti CTSL pAb (ATL-HPA070413)