Anti CTSH pAb (ATL-HPA003524 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003524-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cathepsin H
Gene Name: CTSH
Alternative Gene Name: ACC-4, ACC-5, CPSB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032359: 80%, ENSRNOG00000014064: 82%
Entrez Gene ID: 1512
Uniprot ID: P09668
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFL
Gene Sequence LPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFL
Gene ID - Mouse ENSMUSG00000032359
Gene ID - Rat ENSRNOG00000014064
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTSH pAb (ATL-HPA003524 w/enhanced validation)
Datasheet Anti CTSH pAb (ATL-HPA003524 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTSH pAb (ATL-HPA003524 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CTSH pAb (ATL-HPA003524 w/enhanced validation)
Datasheet Anti CTSH pAb (ATL-HPA003524 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTSH pAb (ATL-HPA003524 w/enhanced validation)
Citations for Anti CTSH pAb (ATL-HPA003524 w/enhanced validation) – 1 Found
Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614.  PubMed