Anti CTSH pAb (ATL-HPA003524 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003524-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CTSH
Alternative Gene Name: ACC-4, ACC-5, CPSB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032359: 80%, ENSRNOG00000014064: 82%
Entrez Gene ID: 1512
Uniprot ID: P09668
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFL |
| Gene Sequence | LPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFL |
| Gene ID - Mouse | ENSMUSG00000032359 |
| Gene ID - Rat | ENSRNOG00000014064 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTSH pAb (ATL-HPA003524 w/enhanced validation) | |
| Datasheet | Anti CTSH pAb (ATL-HPA003524 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CTSH pAb (ATL-HPA003524 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CTSH pAb (ATL-HPA003524 w/enhanced validation) | |
| Datasheet | Anti CTSH pAb (ATL-HPA003524 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CTSH pAb (ATL-HPA003524 w/enhanced validation) |
| Citations for Anti CTSH pAb (ATL-HPA003524 w/enhanced validation) – 1 Found |
| Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614. PubMed |