Anti CTSD pAb (ATL-HPA003001)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003001-100
- Shipping:
- Calculated at Checkout
$486.00
Gene Name: CTSD
Alternative Gene Name: CLN10, CPSD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007891: 86%, ENSRNOG00000020206: 86%
Entrez Gene ID: 1509
Uniprot ID: P07339
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT |
| Gene Sequence | LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT |
| Gene ID - Mouse | ENSMUSG00000007891 |
| Gene ID - Rat | ENSRNOG00000020206 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTSD pAb (ATL-HPA003001) | |
| Datasheet | Anti CTSD pAb (ATL-HPA003001) Datasheet (External Link) |
| Vendor Page | Anti CTSD pAb (ATL-HPA003001) at Atlas Antibodies |
| Documents & Links for Anti CTSD pAb (ATL-HPA003001) | |
| Datasheet | Anti CTSD pAb (ATL-HPA003001) Datasheet (External Link) |
| Vendor Page | Anti CTSD pAb (ATL-HPA003001) |
| Citations for Anti CTSD pAb (ATL-HPA003001) – 2 Found |
| Piras, Antonio; Collin, Ludovic; Grüninger, Fiona; Graff, Caroline; Rönnbäck, Annica. Autophagic and lysosomal defects in human tauopathies: analysis of post-mortem brain from patients with familial Alzheimer disease, corticobasal degeneration and progressive supranuclear palsy. Acta Neuropathologica Communications. 2016;4( 26936765):22. PubMed |
| Ahmad, Yasmeen; Boisvert, Francois-Michel; Lundberg, Emma; Uhlen, Mathias; Lamond, Angus I. Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013680. PubMed |