Anti CTSD pAb (ATL-HPA003001)

Atlas Antibodies

SKU: ATL-HPA003001-100

• 
• 

Protein Description: cathepsin D
Gene Name: CTSD
Alternative Gene Name: CLN10, CPSD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007891: 86%, ENSRNOG00000020206: 86%
Entrez Gene ID: 1509
Uniprot ID: P07339
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT
• Gene Sequence: LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT
• Gene ID - Mouse: ENSMUSG00000007891
• Gene ID - Rat: ENSRNOG00000020206
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CTSD pAb (ATL-HPA003001) – 2 Found

Piras, Antonio; Collin, Ludovic; Grüninger, Fiona; Graff, Caroline; Rönnbäck, Annica. Autophagic and lysosomal defects in human tauopathies: analysis of post-mortem brain from patients with familial Alzheimer disease, corticobasal degeneration and progressive supranuclear palsy. Acta Neuropathologica Communications. 2016;4( 26936765):22. 

Ahmad, Yasmeen; Boisvert, Francois-Michel; Lundberg, Emma; Uhlen, Mathias; Lamond, Angus I. Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013680.