Anti CTSD pAb (ATL-HPA003001)

Atlas Antibodies

Catalog No.:
ATL-HPA003001-100
Shipping:
Calculated at Checkout
$486.00
Adding to cart… The item has been added
Protein Description: cathepsin D
Gene Name: CTSD
Alternative Gene Name: CLN10, CPSD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007891: 86%, ENSRNOG00000020206: 86%
Entrez Gene ID: 1509
Uniprot ID: P07339
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT
Gene Sequence LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT
Gene ID - Mouse ENSMUSG00000007891
Gene ID - Rat ENSRNOG00000020206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTSD pAb (ATL-HPA003001)
Datasheet Anti CTSD pAb (ATL-HPA003001) Datasheet (External Link)
Vendor Page Anti CTSD pAb (ATL-HPA003001) at Atlas Antibodies

Documents & Links for Anti CTSD pAb (ATL-HPA003001)
Datasheet Anti CTSD pAb (ATL-HPA003001) Datasheet (External Link)
Vendor Page Anti CTSD pAb (ATL-HPA003001)
Citations for Anti CTSD pAb (ATL-HPA003001) – 2 Found
Piras, Antonio; Collin, Ludovic; Grüninger, Fiona; Graff, Caroline; Rönnbäck, Annica. Autophagic and lysosomal defects in human tauopathies: analysis of post-mortem brain from patients with familial Alzheimer disease, corticobasal degeneration and progressive supranuclear palsy. Acta Neuropathologica Communications. 2016;4( 26936765):22.  PubMed
Ahmad, Yasmeen; Boisvert, Francois-Michel; Lundberg, Emma; Uhlen, Mathias; Lamond, Angus I. Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013680.  PubMed